DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loco and rgs-1

DIOPT Version :10

Sequence 1:NP_732773.1 Gene:loco / 42672 FlyBaseID:FBgn0020278 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_001255056.1 Gene:rgs-1 / 176415 WormBaseID:WBGene00004344 Length:247 Species:Caenorhabditis elegans


Alignment Length:118 Identity:42/118 - (35%)
Similarity:66/118 - (55%) Gaps:0/118 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   823 SWAGSFERMLQDAAGMQTFSEFLKKEFSAENIYFWTACERYRLLESEADRVAQAREIFAKHLANN 887
            ||..||:.::...:|.:.|:||||.|:|.|||.||.|||..:..::......:||.|:...::..
 Worm    37 SWQQSFDTLMSFKSGQKCFAEFLKSEYSDENILFWQACEELKREKNSEKMEEKARIIYEDFISIL 101

  Fly   888 SSDPVNVDSQARSLTEEKLADAAPDIFAPAQKQIFSLMKFDSYQRFIRSDLYK 940
            |...|::||:.|.:....::....:.|..||.||:.||..|||.||:.|..|:
 Worm   102 SPKEVSLDSKVREIVNTNMSRPTQNTFEDAQHQIYQLMARDSYPRFLTSIFYR 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
locoNP_732773.1 PDZ_RGS12-like 70..145 CDD:467194
PTB_RGS12 251..391 CDD:269984
RGS_R12-like 828..941 CDD:188661 39/113 (35%)
RBD1_RGS12_like 1072..1141 CDD:340515
RBD2_RGS12_like 1142..1212 CDD:340587
GoLoco 1354..1375 CDD:214645
rgs-1NP_001255056.1 RGS 38..154 CDD:470619 40/115 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.