DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loco and rgs-3

DIOPT Version :9

Sequence 1:NP_732773.1 Gene:loco / 42672 FlyBaseID:FBgn0020278 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_495223.1 Gene:rgs-3 / 174020 WormBaseID:WBGene00004346 Length:363 Species:Caenorhabditis elegans


Alignment Length:343 Identity:85/343 - (24%)
Similarity:128/343 - (37%) Gaps:104/343 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   682 NLHKS----HKDRTSMSASSSSHCLLEATNSEPDLGNRALPANASPFRRAWGQSSFRTPRSDKVA 742
            |||.|    |:.|.|.|||.:|.....|:|                      ..:.:.|.::..|
 Worm    22 NLHDSSESDHEGRQSRSASITSSTSAPASN----------------------DVTLQVPITNSSA 64

  Fly   743 KEQQQLGQSSPVRRTASMNASDNDMYIKTLMLDSDLKSSRSQHQLSLLQVPKVLTTPAPPSAITA 807
                    :||...|.|       ||....|.|...|.:|.|                ||...|.
 Worm    65 --------TSPTPSTGS-------MYFIAGMFDGKEKVNREQ----------------PPMPTTD 98

  Fly   808 SVAAEGAAQDHGCPSSW-AGSFERMLQDAAGMQTFSEFLKKEFSAENIYFWTACERYRLLESEAD 871
            .|....||       || ||:...:|.|..|.|.|..||.:..:.||:.|..|.|:.:.::...:
 Worm    99 GVEYPRAA-------SWAAGNCANVLNDDKGKQLFRVFLFQSLAEENLAFLEAMEKLKKMKISDE 156

  Fly   872 RVAQAREIFAKHLANNSSDPVNVDSQARSLTEEKLADAAPDI--FAPAQKQIFSLMKFDSYQRFI 934
            :||.|:||...:..:     :|:.|.:.......:|....|:  ||||.|::..|::.|.:.||.
 Worm   157 KVAYAKEILETYQGS-----INLSSSSMKSLRNAVASETLDMEEFAPAIKEVRRLLENDQFPRFR 216

  Fly   935 RSDLYKSCVEAEQKNQPLPYSGLDLDELLKTNF--------------HLGA--FSKLKKSASNAE 983
            ||:||            |.|    |:|||..::              |:|.  |....:|....|
 Worm   217 RSELY------------LEY----LEELLPRSYAEKWAQSFEGLLGNHVGRHHFRIFLRSIHAEE 265

  Fly   984 DRRRKSLLPWHRKTRSKS 1001
            :.|....:...|.:|.|:
 Worm   266 NLRFWEAVVEFRSSRHKA 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
locoNP_732773.1 PDZ_signaling 69..145 CDD:238492
PTB_RGS12 251..391 CDD:269984
RGS_R12-like 828..941 CDD:188661 34/114 (30%)
RGS12_RBD 1073..1145 CDD:176412
RBD 1144..1213 CDD:128731
rgs-3NP_495223.1 RGS 112..218 CDD:214613 30/110 (27%)
RGS 240..358 CDD:279009 9/44 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.