DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loco and cytip

DIOPT Version :9

Sequence 1:NP_732773.1 Gene:loco / 42672 FlyBaseID:FBgn0020278 Length:1541 Species:Drosophila melanogaster
Sequence 2:XP_003199223.2 Gene:cytip / 100537036 ZFINID:ZDB-GENE-140106-76 Length:343 Species:Danio rerio


Alignment Length:363 Identity:76/363 - (20%)
Similarity:140/363 - (38%) Gaps:110/363 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SGPAPISTSTTPSGSNSQQHQRRRKKRANYNY-NGIRTVEV--RRGYNGFGFTI----------S 86
            |.|..::|......:.||....|....:..:| :..||:.|  ::....|||.:          |
Zfish    40 SSPKNLNTEGMKGRTLSQSQLARTHSNSLVDYTDPQRTMVVLEKQDNEVFGFEVQTYGLKVKNTS 104

  Fly    87 GQQPCRLSC-IISSSPAEQAGLRSGDFLISVNGLNVSKLPHETVVQLIGNSFGSIRMQIAENYYS 150
            ..:.|...| :...|.||.|||.:||.::||||:::....|:.:::||..|..:::::       
Zfish   105 MVEMCTFVCRVQDGSAAETAGLTAGDIILSVNGVSIEGSTHQNIIELIRESSNTLKLE------- 162

  Fly   151 DSSDEENAHATLRGQLLAASLRHKPRFLHHKAKLHRLRNSPQKKLNPPEAVEPHKSKSSPDHPTL 215
                      |:.|.::        :.:..:.|:|.|:.:.::|....:::              
Zfish   163 ----------TVSGSVM--------KRIELEKKMHYLKQTLREKWVELQSL-------------- 195

  Fly   216 KPVLEDPPLT-ANLSKAA---DVANVSAMVRAVG------SAALECRVIV-------GYLGTIEM 263
              .|::..|| .||:::|   .|.:|.::...:|      |:...||.|:       .::.::  
Zfish   196 --TLKEKRLTQGNLNESAQYLSVDSVMSLSSPMGRSGQRFSSDSSCRSIMTDDSEDGAFMSSV-- 256

  Fly   264 PKQISHSSKLQTVRSC-------IRKLRQEKRQPTIVL----MCITPDSLSLQSSSGGVLATYS- 316
               ...||.|..:.|.       :..||...|..:|.|    ..::|...:..||..|.|...| 
Zfish   257 ---FDDSSPLSPIESSGSFFQLEVGALRPITRTRSISLTGSNSSLSPGWETSPSSLFGTLPRRSR 318

  Fly   317 --SAR---LNFVSSSSESENRFFGLVTSAVHNTQIEEE 349
              |.|   |.|:.          ||      |..:|||
Zfish   319 KGSVRKHLLKFIP----------GL------NHSVEEE 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
locoNP_732773.1 PDZ_signaling 69..145 CDD:238492 25/88 (28%)
PTB_RGS12 251..391 CDD:269984 28/123 (23%)
RGS_R12-like 828..941 CDD:188661
RGS12_RBD 1073..1145 CDD:176412
RBD 1144..1213 CDD:128731
cytipXP_003199223.2 PDZ_signaling 78..162 CDD:238492 23/83 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.