DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loco and rgs19

DIOPT Version :9

Sequence 1:NP_732773.1 Gene:loco / 42672 FlyBaseID:FBgn0020278 Length:1541 Species:Drosophila melanogaster
Sequence 2:XP_021325390.1 Gene:rgs19 / 100170801 ZFINID:ZDB-GENE-080723-72 Length:234 Species:Danio rerio


Alignment Length:215 Identity:63/215 - (29%)
Similarity:101/215 - (46%) Gaps:54/215 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   773 MLDSDLKSSRSQHQLSLLQVPKVLTTPAPP--------------SAITASVAAEG------AAQD 817
            |..|:...||:||             |:|.              |....:|.:|.      .||:
Zfish    32 MTRSETSPSRAQH-------------PSPTQKPNTCCFCWCCCCSCSCLTVRSEDDKRGRRKAQE 83

  Fly   818 --------HGCP-------SSWAGSFERMLQDAAGMQTFSEFLKKEFSAENIYFWTACERYRLLE 867
                    ..||       ..||.||::::::..|...|.|||:.|:|.||:.||.|||.   |:
Zfish    84 TKLEPFPWETCPKPTMEEIKQWAQSFDKLMKNPGGRNKFREFLRTEYSEENMLFWLACED---LK 145

  Fly   868 SEADRVA---QAREIFAKHLANNSSDPVNVDSQARSLTEEKLADAAPDIFAPAQKQIFSLMKFDS 929
            :|.::.|   :||.|:..:::..|...|::||:.|.:...::.|..|.||..||.||::||..||
Zfish   146 NEINKSAIEEKARLIYEDYISILSPKEVSLDSRVREVINRRMQDPTPHIFEDAQLQIYTLMHRDS 210

  Fly   930 YQRFIRSDLYKSCVEAEQKN 949
            |.||:.|.:|:|.|:...::
Zfish   211 YPRFLNSSVYRSLVQGGSRS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
locoNP_732773.1 PDZ_signaling 69..145 CDD:238492
PTB_RGS12 251..391 CDD:269984
RGS_R12-like 828..941 CDD:188661 43/115 (37%)
RGS12_RBD 1073..1145 CDD:176412
RBD 1144..1213 CDD:128731
rgs19XP_021325390.1 RGS 67..221 CDD:321993 51/156 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.