DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loco and tamalin

DIOPT Version :9

Sequence 1:NP_732773.1 Gene:loco / 42672 FlyBaseID:FBgn0020278 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_001120354.1 Gene:tamalin / 100145424 XenbaseID:XB-GENE-943584 Length:352 Species:Xenopus tropicalis


Alignment Length:233 Identity:54/233 - (23%)
Similarity:96/233 - (41%) Gaps:52/233 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 AANSGPAPISTSTTPSG----SNSQQHQRRRKKRANYNYNGIRTVEVRRGYNGFGFTISGQQ--- 89
            |.:.|..|.:...:.:|    |.|.::||:           |.|:: :.....|||.|....   
 Frog    49 AVSGGTLPRTKKGSTAGWKNVSQSSEYQRK-----------ILTLQ-KEDSESFGFEIQTYGLHH 101

  Fly    90 -----------PCRLSCIISSSPAEQAGLRSGDFLISVNGLNVSKLPHETVVQLIGNSFGSIRMQ 143
                       .||:.   ..|||:..||:.||.:..|||||:..:.|..:|:||..|..:||: 
 Frog   102 QDKNAVEMFTFVCRVQ---DGSPAQLCGLKVGDIIAGVNGLNMDGVRHRDIVELIKVSGNTIRL- 162

  Fly   144 IAENYYSDSSDEENAHATLRGQLLAASLRHKPRFLHHKAKLHRLRNSPQKKL------NPPEAVE 202
              |..|.         :.:|...|.|.:::..:.|:.|.:.:|.....:::|      ..|...:
 Frog   163 --ETVYG---------SAIRRAELEARIQYLKQTLYEKWEEYRSLMVQEQRLLHGIVVKDPSVYD 216

  Fly   203 PHKSKSSPDHPTLKPVLEDPPLTANLSKAADVANVSAM 240
            ..:|..|..:.|:....:| |||..|:..:..::.|.:
 Frog   217 TLESVRSYIYGTVNTCSKD-PLTGTLAAGSMCSSASCL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
locoNP_732773.1 PDZ_signaling 69..145 CDD:238492 27/89 (30%)
PTB_RGS12 251..391 CDD:269984
RGS_R12-like 828..941 CDD:188661
RGS12_RBD 1073..1145 CDD:176412
RBD 1144..1213 CDD:128731
tamalinNP_001120354.1 PDZ_signaling 78..163 CDD:238492 27/102 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.