DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL45 and KRE29

DIOPT Version :9

Sequence 1:NP_651072.1 Gene:mRpL45 / 42671 FlyBaseID:FBgn0263863 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_010955.3 Gene:KRE29 / 856760 SGDID:S000000840 Length:464 Species:Saccharomyces cerevisiae


Alignment Length:129 Identity:34/129 - (26%)
Similarity:56/129 - (43%) Gaps:14/129 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 YVPPE----GDGKKSIISTSGAK---QKLEFLE--KKSKSLMAVRKIRSYDENFSSDDFGAEAQD 174
            |||.:    ||.....|:|:.||   .|.|.|:  :.:||::......:..|...|..|.....:
Yeast   118 YVPLKIFNLGDSFDDTITTTVAKLQDLKKEILDSPRSNKSIVITSNTVAKSELQKSIKFSGSIPE 182

  Fly   175 IYIQAHTHMAAKDKYKIREFVSERCYPEMMHNVKDKTIRWKFL-----QSLEPPRVVHARVTEV 233
            ||:...|.....||||...|:|:.|:.|.:.:::.|...:.||     ...:.|..||.:...:
Yeast   183 IYLDVVTKETISDKYKDWHFISKNCHYEQLMDLEMKDTAYSFLFGSSRSQGKVPEFVHLKCPSI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL45NP_651072.1 Tim44 152..297 CDD:282178 20/87 (23%)
KRE29NP_010955.3 Nse5 1..454 CDD:370066 34/129 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4599
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.