DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL45 and Mrpl45

DIOPT Version :9

Sequence 1:NP_651072.1 Gene:mRpL45 / 42671 FlyBaseID:FBgn0263863 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_017170202.1 Gene:Mrpl45 / 67036 MGIID:1914286 Length:364 Species:Mus musculus


Alignment Length:321 Identity:118/321 - (36%)
Similarity:172/321 - (53%) Gaps:67/321 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 TKEEMRSRMKERGVLPPRPWMERPFHISCTGGIFEAYVPPEGDGKKSIISTSGAKQKLEFLEKKS 147
            |::|.....::.|::.|:..:|||.|::||.|||:.|||||||.:.|.:|..|..|:.|.|.|.:
Mouse    52 TEKEFLEYARKAGLVIPQERLERPIHLACTAGIFDPYVPPEGDARMSSLSKEGLTQRTERLRKNA 116

  Fly   148 KSLMAVRKIRSYDENFSSDDFGAEAQDIYIQAHTHMAAKDKYKIREFVSERCYP----------- 201
            .|.:|:||||.:|.||.:.||..:|:||:|:||..:...|..::...|:|.|:|           
Mouse   117 ASQLAIRKIREFDANFKTKDFPEKAKDIFIEAHLCLNNSDHDRLHTLVTEHCFPCLKDEISGSTG 181

  Fly   202 -----------------------------------------------EMMHNVKDKTIRWKFLQS 219
                                                           :|:.::|.||:||.|::|
Mouse   182 YRLRPCLHPIPTLKWGERMEALPVGCSIVWAVPHRRGTPVNSSLLPQDMVWDLKYKTVRWGFVES 246

  Fly   220 LEPPRVVHARVTEVITKENQFAQVTVRFHSQQMLAIYDRFGRLMHGSEIITKDVLEYVVFEKHIS 284
            |||.:|||.|.:.::.:.|.:.|||||.|::|.|||||||||||:|.|.:.||||||||||:|:.
Mouse   247 LEPAQVVHVRCSGLVNQSNMYGQVTVRLHTRQTLAIYDRFGRLMYGQEDVPKDVLEYVVFERHLM 311

  Fly   285 NEYGKWRLHDKIIPDWLPAKQPAPITYRLIEDAEEPPKELSAGDAEVKQVDSVGEQSKEQL 345
            |.||.||:|.||:|.|.|.|||...|..:.....:|.:|..         ::.||..|.||
Mouse   312 NPYGSWRMHAKIVPAWAPPKQPILKTLMIPGPQLKPWEEYE---------ETQGEAQKPQL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL45NP_651072.1 Tim44 152..297 CDD:282178 75/202 (37%)
Mrpl45XP_017170202.1 Tim44 119..322 CDD:214950 74/202 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832395
Domainoid 1 1.000 171 1.000 Domainoid score I3738
eggNOG 1 0.900 - - E1_KOG4599
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32647
Inparanoid 1 1.050 248 1.000 Inparanoid score I3236
Isobase 1 0.950 - 0 Normalized mean entropy S4578
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005541
OrthoInspector 1 1.000 - - oto93058
orthoMCL 1 0.900 - - OOG6_104462
Panther 1 1.100 - - LDO PTHR28554
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2761
SonicParanoid 1 1.000 - - X4497
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.730

Return to query results.
Submit another query.