DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL45 and mrpl45

DIOPT Version :9

Sequence 1:NP_651072.1 Gene:mRpL45 / 42671 FlyBaseID:FBgn0263863 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001027509.1 Gene:mrpl45 / 613101 XenbaseID:XB-GENE-958318 Length:309 Species:Xenopus tropicalis


Alignment Length:280 Identity:121/280 - (43%)
Similarity:183/280 - (65%) Gaps:8/280 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RLRKLKFVKMDLPNLREKQEDITKEEMRSRMKERGVLPPRPWMERPFHISCTGGIFEAYVPPEGD 125
            |.:|..|:.   |.:..|.:  |..:|.|:.:..||:.|...||||.:|:||.|||:.|:|||||
 Frog    35 RTKKRYFIP---PAVGAKHK--TMADMISKARAAGVVTPHETMERPINIACTAGIFDPYIPPEGD 94

  Fly   126 GKKSIISTSGAKQKLEFLEKKSKSLMAVRKIRSYDENFSSDDFGAEAQDIYIQAHTHMAAKDKYK 190
            .:.|.:|..|.||:.:.|::.:.|.:|:||::.||..|::..|..:||:::|.||..:...|:::
 Frog    95 ARLSSLSKEGLKQRTQQLKQTAASQLAIRKVKEYDSEFTTKTFPEKAQELFIAAHQCLTKFDRHE 159

  Fly   191 IREFVSERCYPEMMHNVKDKTIRWKFLQSLEPPRVVHARVTEVITKENQFAQVTVRFHSQQMLAI 255
            :...|:|||||||:...:.:||:|.|::|:|.||||..|..|:::|.|.:||||||.|::|.|.|
 Frog   160 LHTLVTERCYPEMVRGNRYRTIQWSFVESIEAPRVVQVRCPEMVSKGNLYAQVTVRMHNKQSLTI 224

  Fly   256 YDRFGRLMHGSEIITKDVLEYVVFEKHISNEYGKWRLHDKIIPDWLPAKQPAPITYRLIEDAEEP 320
            ||||||:|.||| ..:|||||||||:|:.|.||.||:|.||:|.|.|.|:|...|..|...|.:|
 Frog   225 YDRFGRVMCGSE-EPRDVLEYVVFERHMVNPYGTWRMHGKIVPSWAPPKEPIVKTVLLPGPAVDP 288

  Fly   321 PKELSAGDAEVKQVDSVGEQ 340
            .:||.  |..:::.:.|.:|
 Frog   289 LQELE--DISLEKTEPVLQQ 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL45NP_651072.1 Tim44 152..297 CDD:282178 72/144 (50%)
mrpl45NP_001027509.1 Tim44 119..265 CDD:309421 72/146 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 159 1.000 Domainoid score I4036
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32647
Inparanoid 1 1.050 242 1.000 Inparanoid score I3234
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1121890at2759
OrthoFinder 1 1.000 - - FOG0005541
OrthoInspector 1 1.000 - - otm48235
Panther 1 1.100 - - LDO PTHR28554
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2761
SonicParanoid 1 1.000 - - X4497
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.