DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL45 and AT5G27395

DIOPT Version :9

Sequence 1:NP_651072.1 Gene:mRpL45 / 42671 FlyBaseID:FBgn0263863 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001078626.1 Gene:AT5G27395 / 5008229 AraportID:AT5G27395 Length:313 Species:Arabidopsis thaliana


Alignment Length:272 Identity:69/272 - (25%)
Similarity:122/272 - (44%) Gaps:40/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 HRQTKHWKPEFKR----------LRKLKFVKMDLPNLREKQEDITKEEMRSRMKERGVLPPRPWM 103
            |....|.|..:.|          |.:...:...||.:.||:...|:.:...::::.|.:  |..|
plant    56 HVPEAHGKSAYSRLYEGHSVNTHLLRSTMIAEFLPFMNEKRSATTQVKAPPQLQKTGAV--RVSM 118

  Fly   104 ERPFHISCTGGIFEAYVPPEGDGKKSI----ISTSGAKQKLEFLEKKSKSLMAVRKIRSYDENFS 164
            ..|      |.::|.|...|   |.||    .:.||.::..|...::.:|..|:.|:|.  ..:|
plant   119 VSP------GFVYEPYALRE---KISIWRRCFTRSGWRRTKEDFIRELRSAYAIAKLRK--TGYS 172

  Fly   165 SDDFGAEAQDIYIQAHTHMAAKDKYKIREFVSERCYPEMMHNVKDKTIRWK--FLQSLEPP---R 224
            .:.|..||.::|.|.:..||..:|..||:.|:||.|..:.:.:|.:...|.  :.:.:||.   |
plant   173 KNTFYIEALELYKQINIQMANGEKKTIRKNVTERMYSALKNEIKQREAMWDGVYWEMVEPVVKIR 237

  Fly   225 VVHARVTEV--ITKENQFAQVTVRFHSQQMLAIYDRFGRLMHG---SEIITKDVLEYVVFEKHIS 284
            .:.||:..:  ...:..|.|:|:.|.::|....||..|.:..|   .|::.:|:.   ||||.:.
plant   238 TLQARLIGIDRTDLKKAFIQLTLEFLTKQKFEAYDAKGNVAAGDKNKEVLVRDIW---VFEKSLF 299

  Fly   285 NEYGKWRLHDKI 296
            :....|||..:|
plant   300 HTGAYWRLCGRI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL45NP_651072.1 Tim44 152..297 CDD:282178 44/155 (28%)
AT5G27395NP_001078626.1 Tim44 159..311 CDD:282178 44/156 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3962
eggNOG 1 0.900 - - E1_KOG4599
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I2499
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1121890at2759
OrthoFinder 1 1.000 - - FOG0005541
OrthoInspector 1 1.000 - - oto3233
orthoMCL 1 0.900 - - OOG6_104462
Panther 1 1.100 - - LDO PTHR28554
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.