DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31156 and EEPD1

DIOPT Version :9

Sequence 1:NP_651070.3 Gene:CG31156 / 42669 FlyBaseID:FBgn0051156 Length:948 Species:Drosophila melanogaster
Sequence 2:NP_085139.2 Gene:EEPD1 / 80820 HGNCID:22223 Length:569 Species:Homo sapiens


Alignment Length:263 Identity:67/263 - (25%)
Similarity:105/263 - (39%) Gaps:89/263 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   638 KMDTNERSAVSIARRLNDPLSEYVKIEPRHLGVGMYQHDVPEKILTASLNDVVSECVSYVGVDLN 702
            |..:.:.|..|:.|   |.|:|.   :|.||...     ||   ||..:|             :|
Human   103 KGSSAQHSPSSLRR---DLLAEQ---QPHHLATA-----VP---LTPRVN-------------IN 140

  Fly   703 TASLSVLKHIAGLSEKKAEKIIEHRTQKGPFKTRKDLLSVRSIGEKSFVQCAGFV---------- 757
            ||:.:.|..:.|||||.|..|::.|.:.|||::.:||:.:..|.       |.|:          
Human   141 TATPAQLMSVRGLSEKMALSIVDFRREHGPFRSVEDLVRMDGIN-------AAFLDRIRHQVFAE 198

  Fly   758 RIEPRSV---GGQLQNPLDCTWV---HPESYNVVESIVGECDLKLSDVGKAAFIA---SIKQFAS 813
            |..|.|.   ||       .|:.   ||...::  |:..| ||.|...|....|:   |::.|..
Human   199 RSRPPSTHTNGG-------LTFTAKPHPSPTSL--SLQSE-DLDLPPGGPTQIISTRPSVEAFGG 253

  Fly   814 S---QPNLDRIAK----------------QHKLPMERLE--FLLVALQ----RELLQDYRADLDK 853
            :   :|.| |:|.                :..:.|..||  ..|:|:|    ||.|:.:..:|::
Human   254 TRDGRPVL-RLATWNLQGCSVEKANNPGVREVVCMTLLENSIKLLAVQELLDREALEKFCTELNQ 317

  Fly   854 RPL 856
            ..|
Human   318 PTL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31156NP_651070.3 Tex 184..931 CDD:225094 67/263 (25%)
Tex_N 190..362 CDD:286460
Tex_YqgF 527..653 CDD:293526 4/14 (29%)
HHH_3 697..758 CDD:289597 20/70 (29%)
S1_like 870..930 CDD:299122
EEPD1NP_085139.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
ComEA <31..100 CDD:224472
HHH_3 37..95 CDD:289597
comE 69..195 CDD:213597 35/125 (28%)
HHH_3 136..195 CDD:289597 21/78 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..225 7/33 (21%)
MnuA_DNase1-like 261..538 CDD:197338 14/61 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 545..569
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.