DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13843 and CG30393

DIOPT Version :9

Sequence 1:NP_651069.1 Gene:CG13843 / 42668 FlyBaseID:FBgn0038993 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_726044.1 Gene:CG30393 / 246588 FlyBaseID:FBgn0050393 Length:354 Species:Drosophila melanogaster


Alignment Length:254 Identity:56/254 - (22%)
Similarity:102/254 - (40%) Gaps:40/254 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 QKMKALK-NELEQAKPFQIERVKEMRYHGVRYRILAS-STGCTKTYPEYISRMTEERALCEFQRA 182
            |||.||. |:|.|                 ||||... .|.|  |.|:.....:::..:.::...
  Fly    69 QKMAALTLNQLTQ-----------------RYRINTKVDTSC--TCPQIYEIESDDAIINKYYIY 114

  Fly   183 YNIVNQSNTDLSNLYLDMSESKKELDQRVARLDRS------LGSTFLKELDSVLQIIEDLNTYFF 241
            |.::..||.:...:..:|........:..|:|:.:      :|..|.|.:...:.::|:|..||:
  Fly   115 YQVIACSNNNQGWVIHNMRPYVLLFRRECAKLNLNEDSPFIMGDAFHKPIKFFIDLVEELFAYFY 179

  Fly   242 GVIVKLKTWAELMDPMKEHSIEDYLGLLSQETDFRTFMSAGMENCTCKRCDKKDPLKPYLPCWCQ 306
            ...|:....|.::||:..:|||.|..||....||..:....|..|.|.|..::.|...|      
  Fly   180 SGHVQFDCAAHMLDPLDLNSIEYYQKLLEPNEDFANYFKYNMSFCKCLRMPRRCPAHEY------ 238

  Fly   307 MESSED-----VTNLKNFDDDCPKNIAGITQHESDIVTPSDTSLLVRAADEKARLAMNQ 360
            .:..||     |...|.  ..|.:....:.:.||:::....:.:.::...|.:.::..|
  Fly   239 PQVKEDFNATFVNQAKK--KRCARRCEKMAEAESNLLDRKKSIVRLQRPSEMSGISTGQ 295



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471567
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014254
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.