DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and HB6

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_565536.1 Gene:HB6 / 816775 AraportID:AT2G22430 Length:311 Species:Arabidopsis thaliana


Alignment Length:67 Identity:29/67 - (43%)
Similarity:37/67 - (55%) Gaps:2/67 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 SNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQ 149
            |.:|.|  .|..|:|.||..|...|.|...|:.::|..|.|..|||.|||||||.:.|..:||:.
plant    60 SEKKRR--LSINQVKALEKNFELENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLEKD 122

  Fly   150 QG 151
            .|
plant   123 YG 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 24/55 (44%)
HB6NP_565536.1 Homeodomain 62..115 CDD:459649 24/54 (44%)
HALZ 117..158 CDD:460477 3/8 (38%)

Return to query results.
Submit another query.