DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and Nanog

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_082292.1 Gene:Nanog / 71950 MGIID:1919200 Length:305 Species:Mus musculus


Alignment Length:131 Identity:39/131 - (29%)
Similarity:61/131 - (46%) Gaps:37/131 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CNEANDQWLQNEAPTGQELP---------SQRSKL--------------RAISSNRKERTAFSKT 96
            |.||     .:..|:.::||         |.:.||              :.::..:|.||.||:.
Mouse    47 CTEA-----ASPRPSSEDLPLQGSPDSSTSPKQKLSSPEADKGPEEEENKVLARKQKMRTVFSQA 106

  Fly    97 QLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEE---------QQGS 152
            ||..|:..|....||:..:..|::..|.|:.:|||.||||:||||||.:..:         |:||
Mouse   107 QLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQKNQWLKTSNGLIQKGS 171

  Fly   153 S 153
            :
Mouse   172 A 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 25/55 (45%)
NanogNP_082292.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..95 9/52 (17%)
Sufficient for interaction with SALL4. /evidence=ECO:0000269|PubMed:16840789 96..155 27/58 (47%)
Homeodomain 98..153 CDD:459649 25/54 (46%)
Required for DNA-binding. /evidence=ECO:0000250|UniProtKB:Q9H9S0 123..152 13/28 (46%)
PTZ00395 <190..>250 CDD:185594
10 X repeats starting with a Trp in each unit 198..247
Sufficient for transactivation activity 198..247
Sufficient for strong transactivation activity 248..305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.