DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and Nkx6-1

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_113925.1 Gene:Nkx6-1 / 65193 RGDID:69318 Length:365 Species:Rattus norvegicus


Alignment Length:83 Identity:33/83 - (39%)
Similarity:41/83 - (49%) Gaps:1/83 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PSQRSKLRAISSNRKE-RTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNR 137
            |.|.|.|......||. |..||..|:..||..|..:.||....|..:|.:|.:||.|||||||||
  Rat   224 PHQGSILLDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNR 288

  Fly   138 RMKCKRIKLEEQQGSSAK 155
            |.|.::....|...:..|
  Rat   289 RTKWRKKHAAEMATAKKK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 27/56 (48%)
Nkx6-1NP_113925.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..136
Repressor domain. /evidence=ECO:0000250 102..269 16/44 (36%)
Homeodomain 236..294 CDD:459649 27/57 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 295..365 2/12 (17%)
Involved in DNA-binding. /evidence=ECO:0000250 307..365 33/83 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.