DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and lbx2

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001007135.1 Gene:lbx2 / 64276 ZFINID:ZDB-GENE-001206-2 Length:257 Species:Danio rerio


Alignment Length:95 Identity:40/95 - (42%)
Similarity:51/95 - (53%) Gaps:4/95 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 EAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQV 130
            :|..|:|..:...:.:|....||.||||:..|:.:||..|.|..||:...|.:||..|.||..||
Zfish   106 QAAEGREHINAFGQRQASKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQV 170

  Fly   131 KVWFQNRRMKCKRIKLEEQQG---SSAKTP 157
            ..||||||.|.|| .|||.:.   |..|.|
Zfish   171 ITWFQNRRAKLKR-DLEEMKADVESLKKIP 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 28/55 (51%)
lbx2NP_001007135.1 Required for convergent extension movement and hypaxial myogenesis during gastrulation. Required for the formation of thick and thin myofilaments. Required for myod1 expression in the pectoral fin bud. Required for continuous expression of cxcl12a in the posterior lateral mesoderm at the tail bud stage and in adaxial cells at the 10-somite stage. /evidence=ECO:0000269|PubMed:19216761, ECO:0000269|PubMed:22216300, ECO:0000269|PubMed:22406073 1..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Homeodomain 127..183 CDD:459649 28/55 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..257
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.