DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and hoxb6b

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_571613.1 Gene:hoxb6b / 58053 ZFINID:ZDB-GENE-000823-7 Length:224 Species:Danio rerio


Alignment Length:199 Identity:55/199 - (27%)
Similarity:87/199 - (43%) Gaps:56/199 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QESYC---------YEDITKSWLNQTEG--------YTDCSY-----VYDHSASSSYADY----- 47
            |||:.         |.|..:.:.:.|.|        ||...|     |:..|.|:|..||     
Zfish    18 QESFLGQIPLYSSGYTDSLRHYPSATFGATNVQDKVYTSSYYQQAGGVFGRSGSTSACDYSTPNI 82

  Fly    48 ---------------------NKLETNWCNEANDQWLQNEAPTGQELPSQRSKLRAI-----SSN 86
                                 ::.:|:...:..:::...|......:.....::.:.     |:.
Zfish    83 YRSADRSCAIGSLEDSLVLTQDQCKTDCTEQGTERYFSTEDKPCTPVYPWMQRMNSCNGMPGSTG 147

  Fly    87 RKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQG 151
            |:.|..:::.|..:||.||.::.||||.||.||:.||.|||||:|:||||||||.|:   |.:..
Zfish   148 RRGRQTYTRFQTLELEKEFHFNRYLTRRRRIEISHALCLTERQIKIWFQNRRMKWKK---ENKAV 209

  Fly   152 SSAK 155
            :|||
Zfish   210 NSAK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 30/51 (59%)
hoxb6bNP_571613.1 Antp-type hexapeptide 129..134 0/4 (0%)
Homeobox 151..203 CDD:278475 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.