Sequence 1: | NP_732768.1 | Gene: | btn / 42664 | FlyBaseID: | FBgn0014949 | Length: | 158 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571613.1 | Gene: | hoxb6b / 58053 | ZFINID: | ZDB-GENE-000823-7 | Length: | 224 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 55/199 - (27%) |
---|---|---|---|
Similarity: | 87/199 - (43%) | Gaps: | 56/199 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 QESYC---------YEDITKSWLNQTEG--------YTDCSY-----VYDHSASSSYADY----- 47
Fly 48 ---------------------NKLETNWCNEANDQWLQNEAPTGQELPSQRSKLRAI-----SSN 86
Fly 87 RKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQG 151
Fly 152 SSAK 155 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
btn | NP_732768.1 | Homeobox | 90..142 | CDD:278475 | 30/51 (59%) |
hoxb6b | NP_571613.1 | Antp-type hexapeptide | 129..134 | 0/4 (0%) | |
Homeobox | 151..203 | CDD:278475 | 30/51 (59%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X14 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.900 |