DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and hoxa3a

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_571609.1 Gene:hoxa3a / 58049 ZFINID:ZDB-GENE-000823-3 Length:411 Species:Danio rerio


Alignment Length:151 Identity:45/151 - (29%)
Similarity:67/151 - (44%) Gaps:56/151 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKNSHANVYQESYCYEDITKSWLNQTEGYTDCSYVYDHSASSSYADYNKLETNWCNEANDQWLQN 65
            ||.|..|..|:|                   ||.:...|.:.                     :.
Zfish   131 MKESRQNTKQKS-------------------CSIISVESCAG---------------------RQ 155

  Fly    66 EAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQV 130
            ::|.|.            :::::.|||::..||.:||.||.::.||.|.||.|:|..|.|||||:
Zfish   156 KSPPGS------------AASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQI 208

  Fly   131 KVWFQNRRMKCKRIKLEEQQG 151
            |:||||||||.|:    :|:|
Zfish   209 KIWFQNRRMKYKK----DQKG 225

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 31/51 (61%)
hoxa3aNP_571609.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..126