DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and meox2b

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001038589.1 Gene:meox2b / 566969 ZFINID:ZDB-GENE-060503-853 Length:289 Species:Danio rerio


Alignment Length:104 Identity:57/104 - (54%)
Similarity:71/104 - (68%) Gaps:13/104 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 QNEAPTGQELPSQRSKLRAISSN------------RKERTAFSKTQLKQLEAEFCYSNYLTRLRR 116
            ||.:|...|..|.:.|..:..|.            |||||||:|.|:::||:||.:.||||||||
Zfish   139 QNMSPVEPERRSSKGKSDSSDSQDGSYKSDVSSKPRKERTAFTKEQIRELESEFAHHNYLTRLRR 203

  Fly   117 YEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQGSSAK 155
            |||||.|:||||||||||||||||.||:| ..|||::|:
Zfish   204 YEIAVNLDLTERQVKVWFQNRRMKWKRVK-GGQQGAAAR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 40/51 (78%)
meox2bNP_001038589.1 Homeobox 177..229 CDD:278475 40/51 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596835
Domainoid 1 1.000 97 1.000 Domainoid score I7175
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24719
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24328
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.