DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and meox2a

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:XP_017206696.1 Gene:meox2a / 556898 ZFINID:ZDB-GENE-080613-1 Length:302 Species:Danio rerio


Alignment Length:98 Identity:57/98 - (58%)
Similarity:68/98 - (69%) Gaps:15/98 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ELPSQRSKLRAISSN--------------RKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVA 122
            |...:.||.|:.||.              |||||||:|.|:::|||||.:.|||||||||||||.
Zfish   159 EAEKRNSKRRSDSSESQDGNYKSDVSSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVN 223

  Fly   123 LELTERQVKVWFQNRRMKCKRIKLEEQQGSSAK 155
            |:||||||||||||||||.||:| ..|||:.|:
Zfish   224 LDLTERQVKVWFQNRRMKWKRVK-GGQQGAVAR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 41/51 (80%)
meox2aXP_017206696.1 COG5576 161..267 CDD:227863 56/96 (58%)
Homeobox 191..243 CDD:278475 41/51 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596836
Domainoid 1 1.000 97 1.000 Domainoid score I7175
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24719
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24328
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5370
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.