DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and Hoxa7

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001102703.2 Gene:Hoxa7 / 500126 RGDID:1587253 Length:229 Species:Rattus norvegicus


Alignment Length:147 Identity:53/147 - (36%)
Similarity:75/147 - (51%) Gaps:25/147 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YTDCSYVYDHSASSSY-----------ADYNK--------LETNWCNEANDQWLQNEAPTGQEL- 73
            |...|.:|.:..:|||           |.|::        |....|::|::..|...|.....: 
  Rat    55 YNVNSPLYQNPFASSYGLGADAYNLPCASYDQNIPGLCSDLAKGACDKADEGVLHGPAEASFRIY 119

  Fly    74 PSQRSKLRAISSNRKE-RTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNR 137
            |..||.    ..:||. |..:::.|..:||.||.::.||||.||.|||.||.|||||:|:|||||
  Rat   120 PWMRSS----GPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNR 180

  Fly   138 RMKCKRIKLEEQQGSSA 154
            |||.|:...:|.|..:|
  Rat   181 RMKWKKEHKDESQAPTA 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 31/51 (61%)
Hoxa7NP_001102703.2 Homeobox 133..185 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.