DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and hoxa5

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001011405.1 Gene:hoxa5 / 496880 XenbaseID:XB-GENE-486061 Length:274 Species:Xenopus tropicalis


Alignment Length:150 Identity:56/150 - (37%)
Similarity:78/150 - (52%) Gaps:28/150 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ITKSWLNQTEGYTDCSYVYDHSASSSYADYNKLETNWCNEANDQWLQNEAPTGQE--LPSQRSKL 80
            |.:..|..:.|..|     |..|||             ::|:.|..|:.||:.|.  .|..| ||
 Frog   142 INRDGLGASSGAED-----DAPASS-------------DQASSQNSQSPAPSVQPQIYPWMR-KL 187

  Fly    81 RAISSN------RKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRM 139
            .....|      ::.|||:::.|..:||.||.::.||||.||.|||.||.|:|||:|:|||||||
 Frog   188 HISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRM 252

  Fly   140 KCKR-IKLEEQQGSSAKTPF 158
            |.|: .||:....::|...|
 Frog   253 KWKKDNKLKSMSMAAAGGAF 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 32/51 (63%)
hoxa5NP_001011405.1 Homeobox 203..256 CDD:365835 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.