DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and hoxa1

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001008017.1 Gene:hoxa1 / 493379 XenbaseID:XB-GENE-480737 Length:323 Species:Xenopus tropicalis


Alignment Length:179 Identity:56/179 - (31%)
Similarity:83/179 - (46%) Gaps:38/179 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NSHANV---YQESYCYEDITKSWL--NQTEGYTDCSYVYDHSA-----SSSYADYNK-------L 50
            |..|:|   :.:|....:|..|.:  :|.:.|.:.|..|.|.:     :.|.|:||.       .
 Frog   109 NQEADVSAGFPQSVYSGNIASSVVQHHQHQSYIEGSAHYIHHSYGPDQNISVANYNNNVSSLHIS 173

  Fly    51 ETNWCNEANDQ----------WL---QNEAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQLE 102
            :...|...:.:          |:   :|...||     :..:..........||.|:..||.:||
 Frog   174 QREVCRSPSSETSPGPAQTFDWMKVKRNPPKTG-----KAGEYGFAGQPNTARTNFTTKQLTELE 233

  Fly   103 AEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQG 151
            .||.::.||||.||.|||.||:|.|.|||:||||||||.|:   .|::|
 Frog   234 KEFHFNKYLTRARRVEIAAALQLNETQVKIWFQNRRMKQKK---REKEG 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 33/51 (65%)
hoxa1NP_001008017.1 Homeobox 221..274 CDD:365835 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.