DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and hoxc8a

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001005771.1 Gene:hoxc8a / 449648 ZFINID:ZDB-GENE-990415-114 Length:250 Species:Danio rerio


Alignment Length:168 Identity:51/168 - (30%)
Similarity:73/168 - (43%) Gaps:42/168 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YQESYC-------------YEDITKSWLNQTE------GYTDCSYVYDHSASSSYADYNKLETNW 54
            ||::.|             ||.:.:..|..|:      .|.||.   ..::::.......|..|.
Zfish    72 YQQNPCALACHGDATKFYGYEALPRQPLYGTQQEATLAQYPDCK---SSNSTNPGEGQGHLSQNS 133

  Fly    55 CNEANDQWLQNEAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEI 119
            .......|::..||                ..|..|..:|:.|..:||.||.::.||||.||.|:
Zfish   134 SPSLMFPWMRPHAP----------------GRRNGRQTYSRYQTLELEKEFLFNPYLTRKRRIEV 182

  Fly   120 AVALELTERQVKVWFQNRRMKCK----RIKLEEQQGSS 153
            :.||.|||||||:||||||||.|    :.|...|:|.:
Zfish   183 SHALSLTERQVKIWFQNRRMKWKKENNKDKFPGQRGEA 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 31/51 (61%)
hoxc8aNP_001005771.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..152 8/58 (14%)
Antp-type hexapeptide. /evidence=ECO:0000255 138..143 1/4 (25%)
Homeobox 153..205 CDD:278475 31/51 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..250 3/15 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.