DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and hoxc8

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001006787.1 Gene:hoxc8 / 448482 XenbaseID:XB-GENE-480999 Length:242 Species:Xenopus tropicalis


Alignment Length:137 Identity:48/137 - (35%)
Similarity:64/137 - (46%) Gaps:25/137 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YCYEDITKSWL--NQTEG----YTDCSYVYDHSASSSYADYNKLETNWCNEANDQWLQNEAPTGQ 71
            |.||.:.:..|  .|.|.    |.||....:.:.|......|:   |........|::..||   
 Frog    89 YGYEALPRQSLYGAQQEASVVQYPDCKSSSNTNTSEGQGHLNQ---NSSPSLMFPWMRPHAP--- 147

  Fly    72 ELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQN 136
                         ..|..|..:|:.|..:||.||.::.||||.||.|::.||.|||||||:||||
 Frog   148 -------------GRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQN 199

  Fly   137 RRMKCKR 143
            ||||.|:
 Frog   200 RRMKWKK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 31/51 (61%)
hoxc8NP_001006787.1 Homeobox 153..206 CDD:365835 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.