DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and meox1

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001002450.2 Gene:meox1 / 436723 ZFINID:ZDB-GENE-040718-149 Length:253 Species:Danio rerio


Alignment Length:93 Identity:57/93 - (61%)
Similarity:67/93 - (72%) Gaps:11/93 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 QRSKLRAISS--NRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRR 138
            |.|..:|.|:  .|||||||:|.||::|||||.:.|||||||||||||.|:||||||||||||||
Zfish   158 QDSSFKADSNCKARKERTAFTKEQLRELEAEFTHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRR 222

  Fly   139 MKCKRIK---------LEEQQGSSAKTP 157
            ||.||:|         ||..:..||.:|
Zfish   223 MKWKRVKGGQPASPHDLEADELDSAASP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 42/51 (82%)
meox1NP_001002450.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..158 57/93 (61%)
Homeobox 174..226 CDD:278475 42/51 (82%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..253 8/25 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596834
Domainoid 1 1.000 97 1.000 Domainoid score I7175
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24719
orthoMCL 1 0.900 - - OOG6_113416
Panther 1 1.100 - - LDO PTHR24328
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5370
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.