DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and Rhox10

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001020021.1 Gene:Rhox10 / 434769 MGIID:3580249 Length:196 Species:Mus musculus


Alignment Length:114 Identity:26/114 - (22%)
Similarity:46/114 - (40%) Gaps:21/114 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DHSA---SSSYADYNKLETNWCNEANDQWLQNEAPTGQELPSQRSKLRAISSNRKERTAFSKTQL 98
            ||..   :.:|:...:.||                  |..|.:..|.....|.|.....::..|:
Mouse    53 DHPTFKYTQTYSSETRKET------------------QARPKEPEKAAGAVSRRSNSKKYTNAQM 99

  Fly    99 KQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLE 147
            .:||..|..:.|....:|..:|..:::.|.:||.||:.:|.|.:|.:.|
Mouse   100 CELEKAFQETQYPDAHQRKALAKLIDVDECKVKAWFKYKRAKYRRKQKE 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 14/51 (27%)
Rhox10NP_001020021.1 Homeobox 94..143 CDD:278475 14/48 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5451
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.