DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and MEOX2

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_005915.2 Gene:MEOX2 / 4223 HGNCID:7014 Length:304 Species:Homo sapiens


Alignment Length:183 Identity:70/183 - (38%)
Similarity:91/183 - (49%) Gaps:64/183 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YDHSASSSYADYNKLETNW----------------CNE-----------------ANDQWLQNEA 67
            :.|........:..|:|||                |.:                 :|...|.:..
Human    74 HHHHHHHQQQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELGSSPPVLCSNSSSLGSST 138

  Fly    68 PTG----------QEL-PSQ---RS--KLRAISSN--------------RKERTAFSKTQLKQLE 102
            |||          |.| |::   ||  |.::.||:              |||||||:|.|:::||
Human   139 PTGAACAPGDYGRQALSPAEAEKRSGGKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIRELE 203

  Fly   103 AEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQGSSAK 155
            |||.:.|||||||||||||.|:||||||||||||||||.||:| ..|||::|:
Human   204 AEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVK-GGQQGAAAR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 41/51 (80%)
MEOX2NP_005915.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..192 22/117 (19%)
COG5576 160..284 CDD:227863 56/97 (58%)
Homeobox 191..243 CDD:278475 41/51 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160460
Domainoid 1 1.000 96 1.000 Domainoid score I7337
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40397
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24328
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5370
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.