DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and MEOX1

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_004518.1 Gene:MEOX1 / 4222 HGNCID:7013 Length:254 Species:Homo sapiens


Alignment Length:126 Identity:62/126 - (49%)
Similarity:74/126 - (58%) Gaps:21/126 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 DYNKL-----ETNWCNEANDQWLQNEAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEF 105
            ||..|     ||    |......:.|:...||   .|.|....|..|||||||:|.||::|||||
Human   133 DYGVLGSTANET----EKKSSRRRKESSDNQE---NRGKPEGSSKARKERTAFTKEQLRELEAEF 190

  Fly   106 CYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIK---------LEEQQGSSAKTP 157
            .:.|||||||||||||.|:|:||||||||||||||.||:|         .:.:.|.|..:|
Human   191 AHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASP 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 41/51 (80%)
MEOX1NP_004518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..178 17/51 (33%)
Homeobox 175..227 CDD:306543 41/51 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..254 6/25 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160461
Domainoid 1 1.000 96 1.000 Domainoid score I7337
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40397
orthoMCL 1 0.900 - - OOG6_113416
Panther 1 1.100 - - LDO PTHR24328
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.740

Return to query results.
Submit another query.