DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and Antp

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:104 Identity:43/104 - (41%)
Similarity:59/104 - (56%) Gaps:10/104 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 QNEAPTGQELPS-----QRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVAL 123
            ||.......:||     .||:.......::.|..:::.|..:||.||.::.||||.||.|||.||
  Fly   270 QNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL 334

  Fly   124 ELTERQVKVWFQNRRMKCKR-IKLEEQQGSSAK----TP 157
            .|||||:|:||||||||.|: .|.:.:.||..:    ||
  Fly   335 CLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEITP 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 31/51 (61%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 7/35 (20%)
Homeobox 301..354 CDD:395001 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
54.810

Return to query results.
Submit another query.