powered by:
Protein Alignment btn and ftz
DIOPT Version :9
Sequence 1: | NP_732768.1 |
Gene: | btn / 42664 |
FlyBaseID: | FBgn0014949 |
Length: | 158 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_477498.1 |
Gene: | ftz / 40834 |
FlyBaseID: | FBgn0001077 |
Length: | 410 |
Species: | Drosophila melanogaster |
Alignment Length: | 58 |
Identity: | 29/58 - (50%) |
Similarity: | 44/58 - (75%) |
Gaps: | 0/58 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 NRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKR 143
:::.|..:::.|..:||.||.::.|:||.||.:||.||.|:|||:|:||||||||.|:
Fly 254 SKRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKK 311
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
btn | NP_732768.1 |
Homeobox |
90..142 |
CDD:278475 |
28/51 (55%) |
ftz | NP_477498.1 |
FTZ |
1..248 |
CDD:281812 |
|
Homeobox |
257..310 |
CDD:278475 |
28/52 (54%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I4196 |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0489 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D858478at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000007 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.820 |
|
Return to query results.
Submit another query.