DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and zen

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster


Alignment Length:140 Identity:54/140 - (38%)
Similarity:73/140 - (52%) Gaps:19/140 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YTDCSYVYDHSAS-----SSYADYNKLETNWCNEANDQWL-QNEAPTGQELP------SQRSKLR 81
            |:|..|.:.|..:     .:|...|...|...:..:.|.: |....:.:.||      |||.|| 
  Fly    27 YSDLIYGHHHDVNPIGLPPNYNQMNSNPTTLNDHCSPQHVHQQHVSSDENLPSQPNHDSQRVKL- 90

  Fly    82 AISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKR-IK 145
                 ::.||||:..||.:||.||..:.||.|.||.|||..|.|.|||||:||||||||.|: |:
  Fly    91 -----KRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ 150

  Fly   146 LEEQQGSSAK 155
            ...:..|:||
  Fly   151 GHREPKSNAK 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 33/51 (65%)
zenNP_476793.1 Homeobox 93..146 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.