DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and exex

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_648164.1 Gene:exex / 38884 FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster


Alignment Length:86 Identity:37/86 - (43%)
Similarity:51/86 - (59%) Gaps:11/86 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 ISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCK----- 142
            :...|:.||||:..||.:||.:|..:.||:|.:|:|:|..|.|:|.|||:||||||||.|     
  Fly   436 LGKTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKKA 500

  Fly   143 ------RIKLEEQQGSSAKTP 157
                  |.|..:||....:||
  Fly   501 QQEAKERAKANQQQQQQQQTP 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 29/51 (57%)
exexNP_648164.1 Homeobox 442..495 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.