DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and gsb

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster


Alignment Length:77 Identity:29/77 - (37%)
Similarity:42/77 - (54%) Gaps:5/77 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRR 138
            ||.:.|.:    .|:.||.||..|:..||..|..:.|.....|.|:|.:..|||.:|:|||.|||
  Fly   177 PSVQLKRK----QRRSRTTFSNDQIDALERIFARTQYPDVYTREELAQSTGLTEARVQVWFSNRR 237

  Fly   139 MKCKRIKLEEQQ 150
            .:.:: :|..||
  Fly   238 ARLRK-QLNTQQ 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 23/55 (42%)
gsbNP_523863.1 PAX 19..143 CDD:128645
Homeodomain 186..242 CDD:459649 23/55 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.