DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and HOXD11

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_067015.2 Gene:HOXD11 / 3237 HGNCID:5134 Length:338 Species:Homo sapiens


Alignment Length:85 Identity:33/85 - (38%)
Similarity:55/85 - (64%) Gaps:0/85 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 EAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQV 130
            |.|.|:....:.|...|...:||:|..::|.|:::||.||.::.|:.:.:|.:::..|.||:|||
Human   246 EGPPGEAGAEKSSSAVAPQRSRKKRCPYTKYQIRELEREFFFNVYINKEKRLQLSRMLNLTDRQV 310

  Fly   131 KVWFQNRRMKCKRIKLEEQQ 150
            |:||||||||.|::..:..|
Human   311 KIWFQNRRMKEKKLNRDRLQ 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 26/55 (47%)
HOXD11NP_067015.2 DUF3528 26..185 CDD:432284
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..270 7/23 (30%)
Homeodomain 267..323 CDD:459649 26/55 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.