DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and HOXD9

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_055028.3 Gene:HOXD9 / 3235 HGNCID:5140 Length:352 Species:Homo sapiens


Alignment Length:87 Identity:42/87 - (48%)
Similarity:55/87 - (63%) Gaps:2/87 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 QNEAPTGQELPSQRSKLRAI--SSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELT 126
            |:..|..|:|.........|  .|.||:|..::|.|..:||.||.::.||||.||||:|..|.||
Human   261 QHSQPQQQQLDPNNPAANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARILNLT 325

  Fly   127 ERQVKVWFQNRRMKCKRIKLEE 148
            |||||:||||||||.|::..|:
Human   326 ERQVKIWFQNRRMKMKKMSKEK 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 34/55 (62%)
HOXD9NP_055028.3 Hox9_act 11..>164 CDD:461369
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..208
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..276 4/14 (29%)
Homeodomain 286..337 CDD:459649 30/50 (60%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.