DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and HOXD4

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_055436.2 Gene:HOXD4 / 3233 HGNCID:5138 Length:255 Species:Homo sapiens


Alignment Length:106 Identity:40/106 - (37%)
Similarity:64/106 - (60%) Gaps:15/106 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 EAPTGQELPS--------QRSKLRAISSN------RKERTAFSKTQLKQLEAEFCYSNYLTRLRR 116
            :.|:|..|..        ::..:.:::.|      ::.|||:::.|:.:||.||.::.||||.||
Human   120 QPPSGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRR 184

  Fly   117 YEIAVALELTERQVKVWFQNRRMKCKR-IKLEEQQGSSAKT 156
            .|||..|.|:|||:|:||||||||.|: .||...:|.|:.:
Human   185 IEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 31/51 (61%)
HOXD4NP_055436.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..127 2/6 (33%)
Antp-type hexapeptide 133..138 0/4 (0%)
Homeobox 157..210 CDD:306543 31/52 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..255 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.