DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and HOXD3

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_008829.3 Gene:HOXD3 / 3232 HGNCID:5137 Length:432 Species:Homo sapiens


Alignment Length:106 Identity:46/106 - (43%)
Similarity:62/106 - (58%) Gaps:3/106 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SASSSYADYNKLETNWCNEANDQWLQ-NEAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQLE 102
            :||||.|..:|....|..|:.....| |...|..|  |...|.....::::.|||::..||.:||
Human   148 NASSSSATISKQIFPWMKESRQNSKQKNSCATAGE--SCEDKSPPGPASKRVRTAYTSAQLVELE 210

  Fly   103 AEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKR 143
            .||.::.||.|.||.|:|..|.|||||:|:||||||||.|:
Human   211 KEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 31/55 (56%)
HOXD3NP_008829.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..62
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..197 14/50 (28%)
Antp-type hexapeptide 160..165 1/4 (25%)
Homeodomain 195..251 CDD:459649 31/55 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..280
DUF4074 369..430 CDD:463833
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..432
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.