DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and HOXD1

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_078777.1 Gene:HOXD1 / 3231 HGNCID:5132 Length:328 Species:Homo sapiens


Alignment Length:80 Identity:40/80 - (50%)
Similarity:51/80 - (63%) Gaps:6/80 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SQRSKLR---AISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQN 136
            |::.||.   |.|.:...||.||..||.:||.||.::.||||.||.|||..|.|.:.|||:||||
Human   215 SKKGKLAEYGAASPSSAIRTNFSTKQLTELEKEFHFNKYLTRARRIEIANCLHLNDTQVKIWFQN 279

  Fly   137 RRMKCKRIKLEEQQG 151
            ||||.|:   .|::|
Human   280 RRMKQKK---REREG 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 32/55 (58%)
HOXD1NP_078777.1 Antp-type hexapeptide 204..209
Homeodomain 233..286 CDD:459649 32/52 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..328
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.