DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and HOXC12

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_776272.1 Gene:HOXC12 / 3228 HGNCID:5124 Length:282 Species:Homo sapiens


Alignment Length:66 Identity:35/66 - (53%)
Similarity:49/66 - (74%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEE 148
            |.:||:|..:||.||.:||.||..:.::||.||.|::..|.|:::|||:||||||||.||:.|.|
Human   212 SRSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKRLLLRE 276

  Fly   149 Q 149
            |
Human   277 Q 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 29/55 (53%)
HOXC12NP_776272.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..129
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..214 1/1 (100%)
Homeodomain 215..271 CDD:459649 29/55 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.