DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and HOXB7

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_004493.3 Gene:HOXB7 / 3217 HGNCID:5118 Length:217 Species:Homo sapiens


Alignment Length:65 Identity:35/65 - (53%)
Similarity:47/65 - (72%) Gaps:1/65 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LRAISSNRKE-RTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKR 143
            :|:..::||. |..:::.|..:||.||.|:.||||.||.|||..|.|||||:|:||||||||.|:
Human   130 MRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKK 194

  Fly   144  143
            Human   195  194

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 33/56 (59%)