DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and HOXB2

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_002136.1 Gene:HOXB2 / 3212 HGNCID:5113 Length:356 Species:Homo sapiens


Alignment Length:57 Identity:38/57 - (66%)
Similarity:45/57 - (78%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 RKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKR 143
            |:.|||::.|||.:||.||.::.||.|.||.|||..|:||||||||||||||||.||
Human   144 RRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKR 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 36/55 (65%)
HOXB2NP_002136.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..142
Antp-type hexapeptide 94..99
Homeodomain 144..200 CDD:459649 36/55 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..240 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.