DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and HOXA7

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_008827.2 Gene:HOXA7 / 3204 HGNCID:5108 Length:230 Species:Homo sapiens


Alignment Length:160 Identity:54/160 - (33%)
Similarity:78/160 - (48%) Gaps:27/160 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NSHANVYQESYCYEDITKSWLNQTEGYTDCSYVYDHSASSSYADYN------KLETNWCNEANDQ 61
            |.::.:||..:            ..||...:..|.:...:|| |.|      .|....|::.::.
Human    56 NVNSPLYQSPF------------ASGYGLGADAYGNLPCASY-DQNIPGLCSDLAKGACDKTDEG 107

  Fly    62 WLQNEAPTGQEL-PSQRSKLRAISSNRKE-RTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALE 124
            .|...|.....: |..||.    ..:||. |..:::.|..:||.||.::.||||.||.|||.||.
Human   108 ALHGAAEANFRIYPWMRSS----GPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALC 168

  Fly   125 LTERQVKVWFQNRRMKCKRIKLEEQQGSSA 154
            |||||:|:||||||||.|  |..:.:|.:|
Human   169 LTERQIKIWFQNRRMKWK--KEHKDEGPTA 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 31/51 (61%)
HOXA7NP_008827.2 Antp-type hexapeptide 119..124 1/4 (25%)
Homeobox 134..186 CDD:278475 31/51 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..230 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.