DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and HOXA5

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_061975.2 Gene:HOXA5 / 3202 HGNCID:5106 Length:270 Species:Homo sapiens


Alignment Length:166 Identity:58/166 - (34%)
Similarity:83/166 - (50%) Gaps:25/166 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KNSHANVYQESYCYEDITKSWLNQTEGYTDCSYVYDHSASSSYADYNKLETNWCNEANDQWLQNE 66
            |||.:|   .|....|...:.::..||....|...:.:.:||            .:|:.|...:.
Human   119 KNSLSN---SSGASADAGSTHISSREGVGTASGAEEDAPASS------------EQASAQSEPSP 168

  Fly    67 APTGQE--LPSQRSKLRAISSN------RKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVAL 123
            ||..|.  .|..| ||.....|      ::.|||:::.|..:||.||.::.||||.||.|||.||
Human   169 APPAQPQIYPWMR-KLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL 232

  Fly   124 ELTERQVKVWFQNRRMKCKR-IKLEEQQGSSAKTPF 158
            .|:|||:|:||||||||.|: .||:....::|...|
Human   233 CLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGAF 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 32/51 (63%)
HOXA5NP_061975.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 16/70 (23%)
Antp-type hexapeptide 176..181 1/4 (25%)
Homeobox 199..251 CDD:306543 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.