DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and HOXA4

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_002132.3 Gene:HOXA4 / 3201 HGNCID:5105 Length:320 Species:Homo sapiens


Alignment Length:74 Identity:36/74 - (48%)
Similarity:50/74 - (67%) Gaps:6/74 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 RKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKR------IK 145
            ::.|||:::.|:.:||.||.::.||||.||.|||..|.|:|||||:||||||||.|:      .|
Human   216 KRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTK 280

  Fly   146 LEEQQGSSA 154
            :.....:||
Human   281 MRSSNSASA 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 32/55 (58%)
HOXA4NP_002132.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..77
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..168
Antp-type hexapeptide 194..199
Homeodomain 216..272 CDD:459649 32/55 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..320 3/17 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.