DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and Vsx2

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster


Alignment Length:80 Identity:28/80 - (35%)
Similarity:44/80 - (55%) Gaps:5/80 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRR 138
            |:.:.|.:   ..|..||.|:..||::||..|..::|.....|..:::..||.|.:::|||||||
  Fly   221 PNSKKKKK---KRRHSRTIFTSYQLEKLEEAFKEAHYPDVYAREMLSLKTELPEDRIQVWFQNRR 282

  Fly   139 MKCKRIKLEEQQGSS 153
            .|.:  |.|:..|.|
  Fly   283 AKWR--KTEKVWGGS 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 22/55 (40%)
Vsx2NP_001284897.1 Homeodomain 230..287 CDD:459649 22/58 (38%)
OAR 556..572 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.