DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and HLX

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_068777.1 Gene:HLX / 3142 HGNCID:4978 Length:488 Species:Homo sapiens


Alignment Length:112 Identity:40/112 - (35%)
Similarity:53/112 - (47%) Gaps:12/112 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LETNWCNEANDQWLQNEAP------TGQELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYS 108
            |.:|..|....|: |:..|      |...:|....:.|:.|     |..||..|.|.||..|...
Human   240 LNSNPRNSVQHQF-QDTFPGPYAVLTKDTMPQTYKRKRSWS-----RAVFSNLQRKGLEKRFEIQ 298

  Fly   109 NYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQGSSAK 155
            .|:|:..|.::|..|.||:.||||||||||||.:..|..:.|....|
Human   299 KYVTKPDRKQLAAMLGLTDAQVKVWFQNRRMKWRHSKEAQAQKDKDK 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 27/55 (49%)
HLXNP_068777.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..173
Homeodomain 273..333 CDD:459649 29/64 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 331..488 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.