DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and MNX1

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_005506.3 Gene:MNX1 / 3110 HGNCID:4979 Length:401 Species:Homo sapiens


Alignment Length:146 Identity:49/146 - (33%)
Similarity:78/146 - (53%) Gaps:29/146 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VYDHSASSSYA---------DYNKLETNWCNEAN--------------DQWLQNEAPTGQELP-- 74
            ||.:||:::.|         .|:..:....:.|:              ||||: .:..|..||  
Human   163 VYGYSAAAAAAALAGQHPALSYSYPQVQGAHPAHPADPIKLGAGTFQLDQWLR-ASTAGMILPKM 226

  Fly    75 ---SQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQN 136
               :.:::...:...|:.||||:..||.:||.:|..:.||:|.:|:|:|.:|.|||.|||:||||
Human   227 PDFNSQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQN 291

  Fly   137 RRMKCKRIKLEEQQGS 152
            ||||.||.|..::|.:
Human   292 RRMKWKRSKKAKEQAA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 30/51 (59%)
MNX1NP_005506.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..78
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..120
Homeobox 244..297 CDD:278475 30/52 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..401 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.