DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and hoxc3a

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001128157.2 Gene:hoxc3a / 30421 ZFINID:ZDB-GENE-980526-532 Length:263 Species:Danio rerio


Alignment Length:173 Identity:56/173 - (32%)
Similarity:83/173 - (47%) Gaps:25/173 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 HANVYQESYCYEDITKSWLNQTEGYTDCSYVYDHSASSSYADYNKLE--------TNWCNEANDQ 61
            ||   :||....|....|..|........|.:....:.|....|.||        |:..:.....
Zfish    61 HA---EESSSENDKGNVWNFQNLSNVQHPYSFSDDGNHSLDPANALEREKACELSTSCLSTMKYP 122

  Fly    62 WL-QNEAPT----------GQELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLR 115
            |: :..|||          |....|....:...||:::.|.||:.:||.:||.||.:|.||.|.|
Zfish   123 WMRETHAPTHFSSINAMESGDSKYSNGEAVVRNSSSKRARVAFTSSQLLELEKEFHFSAYLCRNR 187

  Fly   116 RYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQGSSAKTPF 158
            |.|:|..|:||:||:|:||||||||.|:   :.::.|:||:.:
Zfish   188 RLEMAELLKLTDRQIKIWFQNRRMKYKK---DHKEKSTAKSSY 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 31/51 (61%)
hoxc3aNP_001128157.2 Abdominal-A 123..246 CDD:332641 43/108 (40%)
Homeobox 162..214 CDD:306543 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.