DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and hoxb8b

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_571256.1 Gene:hoxb8b / 30420 ZFINID:ZDB-GENE-980526-291 Length:247 Species:Danio rerio


Alignment Length:182 Identity:57/182 - (31%)
Similarity:83/182 - (45%) Gaps:39/182 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 HANVYQESYCYEDITKSWLNQTEGYTDCSYVYDHSASSSYADYNKLE------------TNW--C 55
            ||..:.:.|.:.  |.|:.:.:...|.|:..|...|:.:....:.|:            |.:  |
Zfish    51 HAAQFPDFYHHG--TSSFPHASYQQTPCAVAYPGDATGNILGQDGLQKQSFFGAPDSDFTQFGDC 113

  Fly    56 N----EANDQWLQNEAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRR 116
            |    ...|.....|..|.|..|..|.:   .:..|:.|..:|:.|..:||.||.::.||||.||
Zfish   114 NLKVSGIRDDLESAEPCTAQLFPWMRPQ---ATGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRR 175

  Fly   117 YEIAVALELTERQVKVWFQNRRMKCKR----------------IKLEEQQGS 152
            .|::.||.|||||||:||||||||.|:                |:.|.|:||
Zfish   176 IEVSHALALTERQVKIWFQNRRMKWKKEHNKDKFPSSKAEQEEIERERQEGS 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 31/51 (61%)
hoxb8bNP_571256.1 Antp-type hexapeptide 134..139 1/4 (25%)
Homeobox 149..201 CDD:278475 31/51 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..247 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.