DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and hoxd3a

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_571200.1 Gene:hoxd3a / 30349 ZFINID:ZDB-GENE-990415-120 Length:396 Species:Danio rerio


Alignment Length:92 Identity:39/92 - (42%)
Similarity:52/92 - (56%) Gaps:4/92 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 WCNEA--NDQWLQNEAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRR 116
            |..|.  |.:......|...|....:|.....|  ::.|||::..||.:||.||.::.||.|.||
Zfish   129 WMKETRQNAKQKSTNCPAAGETCDDKSPPGPAS--KRVRTAYTSAQLVELEKEFHFNRYLCRPRR 191

  Fly   117 YEIAVALELTERQVKVWFQNRRMKCKR 143
            .|:|..|.|||||:|:||||||||.|:
Zfish   192 VEMANLLNLTERQIKIWFQNRRMKYKK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 31/51 (61%)
hoxd3aNP_571200.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..163 7/35 (20%)
Abdominal-A 116..237 CDD:332641 39/92 (42%)
Antp-type hexapeptide 126..131 1/1 (100%)
Homeobox 165..217 CDD:306543 31/51 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..246 39/92 (42%)
DUF4074 333..394 CDD:315871
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..396
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.